peptides.py is a pure-Python package to compute common descriptors for protein sequences

Last update: Dec 31, 2022

Related tags

Overview

`peptides.py`

Physicochemical properties and indices for amino-acid sequences.

🗺️ Overview

peptides.py is a pure-Python package to compute common descriptors for protein sequences. It is a port of Peptides, the R package written by Daniel Osorio for the same purpose. This library has no external dependency and is available for all modern Python versions (3.6+).

🔧 Installing

Install the peptides package directly from PyPi which hosts universal wheels that can be installed with pip:

$ pip install peptides

💡 Example

Start by creating a Peptide object from a protein sequence:

>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")

Then use the appropriate methods to compute the descriptors you want:

>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...

Methods that return more than one scalar value (for instance, Peptide.blosum_indices) will return a dedicated named tuple:

>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)

Use the Peptide.descriptors method to get a dictionary with every available descriptor. This makes it very easy to create a pandas.DataFrame with descriptors for several protein sequences:

>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ]) >>> df BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4 ... Z2 Z3 Z4 Z5 0 0.367000 -0.436000 -0.239 0.014500 ... -0.711000 -0.104500 -1.486500 0.429500 1 -0.697500 -0.372500 -0.493 0.157000 ... -0.307500 -0.627500 -0.450500 0.362000 2 0.479333 -0.001333 0.138 0.228667 ... -0.299333 0.465333 -0.976667 0.023333 [3 rows x 66 columns] ">

>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5
0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500
1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000
2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333

[3 rows x 66 columns]

💭 Feedback

⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.

🏗️ Contributing

Contributions are more than welcome! See CONTRIBUTING.md for more details.

⚖️ License

This library is provided under the GNU General Public License v3.0. The original R Peptides package was written by Daniel Osorio, Paola Rondón-Villarreal and Rodrigo Torres, and is licensed under the terms of the GPLv2.

This project is in no way not affiliated, sponsored, or otherwise endorsed by the original Peptides authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.

You might also like...

Python Package for DataHerb: create, search, and load datasets.

The Python Package for DataHerb A DataHerb Core Service to Create and Load Datasets.

4 Feb 11, 2022

wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information

Python based Wikidata framework for easy dataframe extraction wikirepo is a Python package that provides a framework to easily source and leverage sta

35 Jan 4, 2023

Python package for processing UC module spectral data.

UC Module Python Package How To Install clone repo. cd UC-module pip install . How to Use uc.module.UC(measurment=str, dark=str, reference=str, heade

1 Oct 20, 2021

sportsdataverse python package

sportsdataverse-py See CHANGELOG.md for details. The goal of sportsdataverse-py is to provide the community with a python package for working with spo

37 Dec 27, 2022

PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

5 Sep 23, 2022

Retail-Sim is python package to easily create synthetic dataset of retaile store.

Retailer's Sale Data Simulation Retail-Sim is python package to easily create synthetic dataset of retaile store. Simulation Model Simulator consists

7 Sep 30, 2022

A python package which can be pip installed to perform statistics and visualize binomial and gaussian distributions of the dataset

GBiStat package A python package to assist programmers with data analysis. This package could be used to plot : Binomial Distribution of the dataset p

4 Oct 17, 2022

VevestaX is an open source Python package for ML Engineers and Data Scientists.

VevestaX Track failed and successful experiments as well as features. VevestaX is an open source Python package for ML Engineers and Data Scientists.

24 Dec 14, 2022

nrgpy is the Python package for processing NRG Data Files

nrgpy nrgpy is the Python package for processing NRG Data Files Website and source: https://github.com/nrgpy/nrgpy Documentation: https://nrgpy.github

23 Dec 8, 2022

Comments

Per-residue data

It seems that the API can only output single statistics for the entire peptide chain, but I'm interested in statistics for each residue individually. I'm wondering if it might be possible to output an array/list from some of these functions instead of always averaging them as is done now.
enhancement

opened by multimeric 1

Hydrophobic moment is inconsistent with R version

Computed hydrophobic moment is not the same as the one computed by R. More specifically, it seems that peptides.py always outputs 0 for the hydrophobic moment when peptide length is shorter than the set window. The returned value matches the value from R when peptide length is equal to or greater than the set window length.

Example in python:

>>> import peptides`
>>> peptides.Peptide("MLK").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("AACQ").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("FGGIQ").hydrophobic_moment(window=5, angle=100)
0.31847187610377536

Example in R:

> library(Peptides)
> hmoment(seq="MLK", window=5, angle=100)
[1] 0.8099386
> hmoment(seq="AACQ", window=5, angle=100)
[1] 0.3152961
> hmoment(seq="FGGIQ", window=5, angle=100)
[1] 0.3184719

I think that it can be easily fixed by internally setting the window length to the length of the peptide if the latter is shorter. What I propose:

--- a/peptides/__init__.py
+++ b/peptides/__init__.py
@@ -657,6 +657,7 @@ class Peptide(typing.Sequence[str]):
               :doi:`10.1073/pnas.81.1.140`. :pmid:`6582470`.

         """
+        window = min(window, len(self))
         scale = tables.HYDROPHOBICITY["Eisenberg"]
         lut = [scale.get(aa, 0.0) for aa in self._CODE1]
         angles = [(angle * i) % 360 for i in range(window)]

bug

opened by eotovic 1

RuntimeWarning in auto_correlation function()
Hi, thank you for creating peptides.py.

Some hydrophobicity tables together with certain proteins cause a runtime warning for in the function auto_correlation():

import peptides for hydro in peptides.tables.HYDROPHOBICITY.keys(): print(hydro) table = peptides.tables.HYDROPHOBICITY[hydro] peptides.Peptide('MANTQNISIWWWAR').auto_correlation(table)

Warning (s2 == 0):

RuntimeWarning: invalid value encountered in double_scalars return s1 / s2

The tables concerned are: octanolScale_pH2, interfaceScale_pH2, oiScale_pH2 Some other proteins causing the same warning: ['MSYGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGYGY', 'MFILLIIIGASCFGGGGGCGYGGYGGYAGGYGGYCC', 'MSFGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGGF']
opened by jhahnfeld 0

Releases(v0.3.1)

v0.3.1(Sep 1, 2022)
Fixed

peptides.datasets data files missing from the source distribution.

Source code(tar.gz)
Source code(zip)
v0.3.0(Sep 1, 2022)
Added

Peptide.linker_preference_profile to build a profile like used in the DomCut method from Suyama & Ohara (2002).

Peptide.profile to build a generic per-residue profile from a data table (#3).

Source code(tar.gz)
Source code(zip)
v0.2.0(Oct 25, 2021)
Added

Peptide.counts method to get the number of occurences of each amino acid in the peptide.

Peptide.frequencies to get the frequencies of each amino acid in the peptide.

Peptide.pcp_descriptors to compute the PCP descriptors from Mathura & Braun (2001).

Peptide.sneath_vectors to compute the descriptors from Sneath (1966).

Hydrophilicity descriptors from Barley (2018).

Peptide.structural_class to predict the structural class of a protein using one of three reference datasets and one of four distance metrics.

Changed

Peptide.aliphatic_index now supports unknown Leu/Ile residue (code J).

Swap order of Peptide.hydrophobic_moment arguments for consistency with profile methods.

Some Peptide functions now support vectorized code using numpy if available.

Source code(tar.gz)
Source code(zip)
v0.1.0(Oct 21, 2021)

Initial release.
Source code(tar.gz)
Source code(zip)

Owner

Martin Larralde

PhD candidate in Bioinformatics, passionate about programming, Pythonista, Rustacean. I write poems, and sometimes they are executable.

GitHub Repository

Two phase pipeline + StreamlitTwo phase pipeline + Streamlit

Two phase pipeline + Streamlit This is an example project that demonstrates how to create a pipeline that consists of two phases of execution. In betw

1 Nov 17, 2021

Spectacular AI SDK fuses data from cameras and IMU sensors and outputs an accurate 6-degree-of-freedom pose of a device.

Spectacular AI SDK examples Spectacular AI SDK fuses data from cameras and IMU sensors (accelerometer and gyroscope) and outputs an accurate 6-degree-

94 Jan 04, 2023

Synthetic data need to preserve the statistical properties of real data in terms of their individual behavior and (inter-)dependences

Synthetic data need to preserve the statistical properties of real data in terms of their individual behavior and (inter-)dependences. Copula and functional Principle Component Analysis (fPCA) are st

32 Dec 20, 2022

AWS Glue ETL Code Samples

AWS Glue ETL Code Samples This repository has samples that demonstrate various aspects of the new AWS Glue service, as well as various AWS Glue utilit

1.2k Jan 03, 2023

Accurately separate the TLD from the registered domain and subdomains of a URL, using the Public Suffix List.

tldextract Python Module tldextract accurately separates the gTLD or ccTLD (generic or country code top-level domain) from the registered domain and s

1.6k Jan 03, 2023

Uses MIT/MEDSL, New York Times, and US Census datasources to analyze per-county COVID-19 deaths.

Covid County Executive summary Setup Install miniconda, then in the command line, run conda create -n covid-county conda activate covid-county conda i

1 Dec 22, 2021

The micro-framework to create dataframes from functions.

762 Jan 07, 2023

Convert monolithic Jupyter notebooks into Ploomber pipelines.

65 Dec 16, 2022

Used for data processing in machine learning, and help us to construct ML model more easily from scratch

Used for data processing in machine learning, and help us to construct ML model more easily from scratch. Can be used in linear model, logistic regression model, and decision tree.

0 Jul 05, 2022

This is a tool for speculation of ancestral allel, calculation of sfs and drawing its bar plot.

superSFS This is a tool for speculation of ancestral allel, calculation of sfs and drawing its bar plot. It is easy-to-use and runing fast. What you s

3 Dec 16, 2022

Single machine, multiple cards training; mix-precision training; DALI data loader.

Template Script Category Description Category script comparison script train.py, loader.py for single-machine-multiple-cards training train_DP.py, tra

2 Jun 27, 2022

Dbt-core - dbt enables data analysts and engineers to transform their data using the same practices that software engineers use to build applications.

6.3k Jan 08, 2023

Finds, downloads, parses, and standardizes public bikeshare data into a standard pandas dataframe format

Finds, downloads, parses, and standardizes public bikeshare data into a standard pandas dataframe format.

2 Dec 01, 2021

SNV calling pipeline developed explicitly to process individual or trio vcf files obtained from Illumina based pipeline (grch37/grch38).

SNV Pipeline SNV calling pipeline developed explicitly to process individual or trio vcf files obtained from Illumina based pipeline (grch37/grch38).

1 Nov 02, 2021