rxn-aa-mapper
Reactions SMILES-AA sequence mapping
setup
conda env create -f conda.yml
conda activate rxn_aa_mapper
In the following we consider on examples provided to show how to use RXNAAMapper.
generate a vocabulary to be used with the EnzymaticReactionBertTokenizer
Create a vocabulary compatible with the enzymatic reaction tokenizer:
create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"
use the tokenizer
Using the examples vocabulary and AA tokenizer provided, we can observe the enzymatic reaction tokenizer in action:
from rxn_aa_mapper.tokenization import EnzymaticReactionBertTokenizer
tokenizer = EnzymaticReactionBertTokenizer(
vocabulary_file="./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
aa_sequence_tokenizer_filepath="./examples/token_75K_min_600_max_750_500K.json"
)
tokenizer.tokenize("NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]")
train the model
The mlm-trainer script can be used to train a model via MTL:
mlm-trainer \
./examples/data-samples/biochemical ./examples/data-samples/biochemical \ # just a sample, simply split data in a train and a validation folder
./examples/vocabulary_token_75K_min_600_max_750_500K.txt /tmp/mlm-trainer-log \
./examples/sample-config.json "*.csv" 1 \ # for a more realistic config see ./examples/config.json
./examples/data-samples/organic ./examples/data-samples/organic \ # just a sample, simply split data in a train and a validation folder
./examples/token_75K_min_600_max_750_500K.json
Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.
Those can be turned into an HuggingFace model by simply running:
checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.json
predict active site
The trained model can used to map reactant atoms to AA sequence locations that potentially represent the active site.
from rxn_aa_mapper.aa_mapper import RXNAAMapper
config_mapper = {
"vocabulary_file": "./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
"aa_sequence_tokenizer_filepath": "./examples/token_75K_min_600_max_750_500K.json",
"model_path": "/tmp/rxnaamapper-pretrained-model",
"head": 3,
"layers": [11],
"top_k": 1,
}
mapper = RXNAAMapper(config=config_mapper)
mapper.get_reactant_aa_sequence_attention_guided_maps(["NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"])
citation
@article{dassi2021identification,
title={Identification of Enzymatic Active Sites with Unsupervised Language Modeling},
author={Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Teukam, Yves Gaetan Nana and Laino, Teodoro},
year={2021}
conference={AI for Science: Mind the Gaps at NeurIPS 2021, ELLIS Machine Learning for Molecule Discovery Workshop 2021}
}
2 Oct 18, 2021
259 Jan 08, 2023
585 Dec 31, 2022
268 Jan 09, 2023
84 Oct 15, 2022
121 Dec 25, 2022
2 Feb 02, 2022
50 Nov 12, 2022
17 Feb 22, 2022
23 Dec 26, 2022
1.9k Jan 06, 2023
19 Nov 29, 2022
39 Sep 28, 2022
93 Dec 29, 2022
1k Nov 29, 2022
1 Feb 09, 2022
4 Jan 05, 2023
12 Jan 01, 2023
1.1k Dec 29, 2022
1.3k Nov 24, 2022