Reaction SMILES-AA mapping via language modelling

Related tags

Deep Learningrxnaamapper
Overview

rxn-aa-mapper

Reactions SMILES-AA sequence mapping

setup

conda env create -f conda.yml
conda activate rxn_aa_mapper

In the following we consider on examples provided to show how to use RXNAAMapper.

generate a vocabulary to be used with the EnzymaticReactionBertTokenizer

Create a vocabulary compatible with the enzymatic reaction tokenizer:

create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"

use the tokenizer

Using the examples vocabulary and AA tokenizer provided, we can observe the enzymatic reaction tokenizer in action:

from rxn_aa_mapper.tokenization import EnzymaticReactionBertTokenizer

tokenizer = EnzymaticReactionBertTokenizer(
    vocabulary_file="./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    aa_sequence_tokenizer_filepath="./examples/token_75K_min_600_max_750_500K.json"
)
tokenizer.tokenize("NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]")

train the model

The mlm-trainer script can be used to train a model via MTL:

mlm-trainer \
    ./examples/data-samples/biochemical ./examples/data-samples/biochemical \  # just a sample, simply split data in a train and a validation folder
    ./examples/vocabulary_token_75K_min_600_max_750_500K.txt /tmp/mlm-trainer-log \
    ./examples/sample-config.json "*.csv" 1 \  # for a more realistic config see ./examples/config.json
    ./examples/data-samples/organic ./examples/data-samples/organic \  # just a sample, simply split data in a train and a validation folder
    ./examples/token_75K_min_600_max_750_500K.json

Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.

Those can be turned into an HuggingFace model by simply running:

checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.json

predict active site

The trained model can used to map reactant atoms to AA sequence locations that potentially represent the active site.

from rxn_aa_mapper.aa_mapper import RXNAAMapper

config_mapper = {
    "vocabulary_file": "./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    "aa_sequence_tokenizer_filepath": "./examples/token_75K_min_600_max_750_500K.json",
    "model_path": "/tmp/rxnaamapper-pretrained-model",
    "head": 3,
    "layers": [11],
    "top_k": 1,
}
mapper = RXNAAMapper(config=config_mapper)
mapper.get_reactant_aa_sequence_attention_guided_maps(["NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"])

citation

@article{dassi2021identification,
  title={Identification of Enzymatic Active Sites with Unsupervised Language Modeling},
  author={Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Teukam, Yves Gaetan Nana and Laino, Teodoro},
  year={2021}
  conference={AI for Science: Mind the Gaps at NeurIPS 2021, ELLIS Machine Learning for Molecule Discovery Workshop 2021}
}
Owner
GitHub Repository
Time-Optimal Planning for Quadrotor Waypoint Flight

Time-Optimal Planning for Quadrotor Waypoint Flight This is an example implementation of the paper "Time-Optimal Planning for Quadrotor Waypoint Fligh

Robotics and Perception Group 38 Dec 02, 2022
Embracing Single Stride 3D Object Detector with Sparse Transformer

SST: Single-stride Sparse Transformer This is the official implementation of paper: Embracing Single Stride 3D Object Detector with Sparse Transformer

TuSimple 385 Dec 28, 2022
A trusty face recognition research platform developed by Tencent Youtu Lab

Introduction TFace: A trusty face recognition research platform developed by Tencent Youtu Lab. It provides a high-performance distributed training fr

Tencent 956 Jan 01, 2023
Official PyTorch implementation of PS-KD

Self-Knowledge Distillation with Progressive Refinement of Targets (PS-KD) Accepted at ICCV 2021, oral presentation Official PyTorch implementation of

61 Dec 28, 2022
DNA-RECON { Automatic Web Reconnaissance Tool }

ABOUT TOOL : DNA-RECON is an automatic web reconnaissance tool written in python. This tool made for reconnaissance and information gathering with an

NIKUNJ BHATT 25 Aug 11, 2021
Small utility to demangle Nim symbols in callgrind files

nim_callgrind A small utility to demangle Nim symbols from callgrind files. Usage Run your (Nim) program with something like this: valgrind --tool=cal

kraptor 3 Feb 15, 2022
Minimal implementation and experiments of "No-Transaction Band Network: A Neural Network Architecture for Efficient Deep Hedging".

No-Transaction Band Network: A Neural Network Architecture for Efficient Deep Hedging Minimal implementation and experiments of "No-Transaction Band N

19 Jan 03, 2023
Age and Gender prediction using Keras

cnn_age_gender Age and Gender prediction using Keras Dataset example : Description : UTKFace dataset is a large-scale face dataset with long age span

XN3UR0N 58 May 03, 2022
Simple, efficient and flexible vision toolbox for mxnet framework.

MXbox: Simple, efficient and flexible vision toolbox for mxnet framework. MXbox is a toolbox aiming to provide a general and simple interface for visi

Ligeng Zhu 31 Oct 19, 2019
Improving Object Detection by Estimating Bounding Box Quality Accurately

Improving Object Detection by Estimating Bounding Box Quality Accurately Abstrac

2 Apr 14, 2022
Python script that analyses the given datasets and comes up with the best polynomial regression representation with the smallest polynomial degree possible

Python script that analyses the given datasets and comes up with the best polynomial regression representation with the smallest polynomial degree possible, to be the most reliable with the least com

Nikolas B Virionis 2 Aug 01, 2022
The aim of the game, as in the original one, is to find a specific image from a group of different images of a person's face

GUESS WHO Main Links: [Github] [App] Related Links: [CLIP] [Celeba] The aim of the game, as in the original one, is to find a specific image from a gr

Arnau - DIMAI 3 Jan 04, 2022
Weakly Supervised Segmentation by Tensorflow.

Weakly Supervised Segmentation by Tensorflow. Implements semantic segmentation in Simple Does It: Weakly Supervised Instance and Semantic Segmentation, by Khoreva et al. (CVPR 2017).

CHENG-YOU LU 52 Dec 27, 2022
This game was designed to encourage young people not to gamble on lotteries, as the probablity of correctly guessing the number is infinitesimal!

Lottery Simulator 2022 for Web Launch Application Developed by John Seong in Ontario. This game was designed to encourage young people not to gamble o

John Seong 2 Sep 02, 2022
An implementation of shampoo

shampoo.pytorch An implementation of shampoo, proposed in Shampoo : Preconditioned Stochastic Tensor Optimization by Vineet Gupta, Tomer Koren and Yor

Ryuichiro Hataya 69 Sep 10, 2022
QI-Q RoboMaster2022 CV Algorithm

QI-Q RoboMaster2022 CV Algorithm

2 Jan 10, 2022
A python implementation of Deep-Image-Analogy based on pytorch.

Deep-Image-Analogy This project is a python implementation of Deep Image Analogy.https://arxiv.org/abs/1705.01088. Some results Requirements python 3

Peng Lu 171 Dec 14, 2022
Measuring and Improving Consistency in Pretrained Language Models

ParaRel 🤘 This repository contains the code and data for the paper: Measuring and Improving Consistency in Pretrained Language Models as well as the

Yanai Elazar 26 Dec 02, 2022
(ICCV 2021 Oral) Re-distributing Biased Pseudo Labels for Semi-supervised Semantic Segmentation: A Baseline Investigation.

DARS Code release for the paper "Re-distributing Biased Pseudo Labels for Semi-supervised Semantic Segmentation: A Baseline Investigation", ICCV 2021

CVMI Lab 58 Jan 01, 2023
NExT-QA: Next Phase of Question-Answering to Explaining Temporal Actions (CVPR2021)

NExT-QA We reproduce some SOTA VideoQA methods to provide benchmark results for our NExT-QA dataset accepted to CVPR2021 (with 1 'Strong Accept' and 2

Junbin Xiao 50 Nov 24, 2022