peptides.py is a pure-Python package to compute common descriptors for protein sequences

Related tags

Data Analysispeptides.py
Overview

peptides.py Stars

Physicochemical properties and indices for amino-acid sequences.

Actions Coverage PyPI Wheel Python Versions Python Implementations License Source Mirror GitHub issues Changelog Downloads

🗺️ Overview

peptides.py is a pure-Python package to compute common descriptors for protein sequences. It is a port of Peptides, the R package written by Daniel Osorio for the same purpose. This library has no external dependency and is available for all modern Python versions (3.6+).

🔧 Installing

Install the peptides package directly from PyPi which hosts universal wheels that can be installed with pip:

$ pip install peptides

💡 Example

Start by creating a Peptide object from a protein sequence:

>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")

Then use the appropriate methods to compute the descriptors you want:

>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...

Methods that return more than one scalar value (for instance, Peptide.blosum_indices) will return a dedicated named tuple:

>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)

Use the Peptide.descriptors method to get a dictionary with every available descriptor. This makes it very easy to create a pandas.DataFrame with descriptors for several protein sequences:

>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ]) >>> df BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4 ... Z2 Z3 Z4 Z5 0 0.367000 -0.436000 -0.239 0.014500 ... -0.711000 -0.104500 -1.486500 0.429500 1 -0.697500 -0.372500 -0.493 0.157000 ... -0.307500 -0.627500 -0.450500 0.362000 2 0.479333 -0.001333 0.138 0.228667 ... -0.299333 0.465333 -0.976667 0.023333 [3 rows x 66 columns] "> 
>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5
0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500
1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000
2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333

[3 rows x 66 columns]

💭 Feedback

⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.

🏗️ Contributing

Contributions are more than welcome! See CONTRIBUTING.md for more details.

⚖️ License

This library is provided under the GNU General Public License v3.0. The original R Peptides package was written by Daniel Osorio, Paola Rondón-Villarreal and Rodrigo Torres, and is licensed under the terms of the GPLv2.

This project is in no way not affiliated, sponsored, or otherwise endorsed by the original Peptides authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.

You might also like...
Python Package for DataHerb: create, search, and load datasets.
Python Package for DataHerb: create, search, and load datasets.

The Python Package for DataHerb A DataHerb Core Service to Create and Load Datasets.

DataHerb 4 Feb 11, 2022
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information

Python based Wikidata framework for easy dataframe extraction wikirepo is a Python package that provides a framework to easily source and leverage sta

Andrew Tavis McAllister 35 Jan 4, 2023
Python package for processing UC module spectral data.

UC Module Python Package How To Install clone repo. cd UC-module pip install . How to Use uc.module.UC(measurment=str, dark=str, reference=str, heade

Nicolai Haaber Junge 1 Oct 20, 2021
sportsdataverse python package
sportsdataverse python package

sportsdataverse-py See CHANGELOG.md for details. The goal of sportsdataverse-py is to provide the community with a python package for working with spo

Saiem Gilani 37 Dec 27, 2022
PyEmits, a python package for easy manipulation in time-series data.
PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

Thompson 5 Sep 23, 2022
Retail-Sim is python package to easily create synthetic dataset of retaile store.

Retailer's Sale Data Simulation Retail-Sim is python package to easily create synthetic dataset of retaile store. Simulation Model Simulator consists

Corca AI 7 Sep 30, 2022
A python package which can be pip installed to perform statistics and visualize binomial and gaussian distributions of the dataset

GBiStat package A python package to assist programmers with data analysis. This package could be used to plot : Binomial Distribution of the dataset p

Rishikesh S 4 Oct 17, 2022
VevestaX is an open source Python package for ML Engineers and Data Scientists.
VevestaX is an open source Python package for ML Engineers and Data Scientists.

VevestaX Track failed and successful experiments as well as features. VevestaX is an open source Python package for ML Engineers and Data Scientists.

Vevesta 24 Dec 14, 2022
nrgpy is the Python package for processing NRG Data Files

nrgpy nrgpy is the Python package for processing NRG Data Files Website and source: https://github.com/nrgpy/nrgpy Documentation: https://nrgpy.github

NRG Tech Services 23 Dec 8, 2022
Comments
  • Per-residue data

    Per-residue data

    It seems that the API can only output single statistics for the entire peptide chain, but I'm interested in statistics for each residue individually. I'm wondering if it might be possible to output an array/list from some of these functions instead of always averaging them as is done now.

    enhancement 
    opened by multimeric 1
  • Hydrophobic moment is inconsistent with R version

    Hydrophobic moment is inconsistent with R version

    Computed hydrophobic moment is not the same as the one computed by R. More specifically, it seems that peptides.py always outputs 0 for the hydrophobic moment when peptide length is shorter than the set window. The returned value matches the value from R when peptide length is equal to or greater than the set window length.

    Example in python:

    >>> import peptides`
>>> peptides.Peptide("MLK").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("AACQ").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("FGGIQ").hydrophobic_moment(window=5, angle=100)
0.31847187610377536

    Example in R:

    > library(Peptides)
> hmoment(seq="MLK", window=5, angle=100)
[1] 0.8099386
> hmoment(seq="AACQ", window=5, angle=100)
[1] 0.3152961
> hmoment(seq="FGGIQ", window=5, angle=100)
[1] 0.3184719

    I think that it can be easily fixed by internally setting the window length to the length of the peptide if the latter is shorter. What I propose:

    --- a/peptides/__init__.py
+++ b/peptides/__init__.py
@@ -657,6 +657,7 @@ class Peptide(typing.Sequence[str]):
               :doi:`10.1073/pnas.81.1.140`. :pmid:`6582470`.

         """
+        window = min(window, len(self))
         scale = tables.HYDROPHOBICITY["Eisenberg"]
         lut = [scale.get(aa, 0.0) for aa in self._CODE1]
         angles = [(angle * i) % 360 for i in range(window)]
    bug 
    opened by eotovic 1
  • RuntimeWarning in auto_correlation function()

    RuntimeWarning in auto_correlation function()

    Hi, thank you for creating peptides.py.

    Some hydrophobicity tables together with certain proteins cause a runtime warning for in the function auto_correlation():

    import peptides

for hydro in peptides.tables.HYDROPHOBICITY.keys():
    print(hydro)
    table = peptides.tables.HYDROPHOBICITY[hydro]
    peptides.Peptide('MANTQNISIWWWAR').auto_correlation(table)

    Warning (s2 == 0):

    RuntimeWarning: invalid value encountered in double_scalars
  return s1 / s2

    The tables concerned are: octanolScale_pH2, interfaceScale_pH2, oiScale_pH2 Some other proteins causing the same warning: ['MSYGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGYGY', 'MFILLIIIGASCFGGGGGCGYGGYGGYAGGYGGYCC', 'MSFGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGGF']

    opened by jhahnfeld 0
Releases(v0.3.1)

  • v0.3.1(Sep 1, 2022)

  • v0.3.0(Sep 1, 2022)

    Added

    • Peptide.linker_preference_profile to build a profile like used in the DomCut method from Suyama & Ohara (2002).
    • Peptide.profile to build a generic per-residue profile from a data table (#3).
    Source code(tar.gz)
    Source code(zip)

  • v0.2.0(Oct 25, 2021)

    Added

    • Peptide.counts method to get the number of occurences of each amino acid in the peptide.
    • Peptide.frequencies to get the frequencies of each amino acid in the peptide.
    • Peptide.pcp_descriptors to compute the PCP descriptors from Mathura & Braun (2001).
    • Peptide.sneath_vectors to compute the descriptors from Sneath (1966).
    • Hydrophilicity descriptors from Barley (2018).
    • Peptide.structural_class to predict the structural class of a protein using one of three reference datasets and one of four distance metrics.

    Changed

    • Peptide.aliphatic_index now supports unknown Leu/Ile residue (code J).
    • Swap order of Peptide.hydrophobic_moment arguments for consistency with profile methods.
    • Some Peptide functions now support vectorized code using numpy if available.
    Source code(tar.gz)
    Source code(zip)

  • v0.1.0(Oct 21, 2021)

Owner
Martin Larralde
PhD candidate in Bioinformatics, passionate about programming, Pythonista, Rustacean. I write poems, and sometimes they are executable.
Martin Larralde
GitHub Repository
Hatchet is a Python-based library that allows Pandas dataframes to be indexed by structured tree and graph data.

Hatchet Hatchet is a Python-based library that allows Pandas dataframes to be indexed by structured tree and graph data. It is intended for analyzing

Lawrence Livermore National Laboratory 14 Aug 19, 2022
Python Implementation of Scalable In-Memory Updatable Bitmap Indexing

PyUpBit CS490 Large Scale Data Analytics — Implementation of Updatable Compressed Bitmap Indexing Paper Table of Contents About The Project Usage Cont

Hyeong Kyun (Daniel) Park 1 Jun 28, 2022
Generate lookml for views from dbt models

dbt2looker Use dbt2looker to generate Looker view files automatically from dbt models. Features Column descriptions synced to looker Dimension for eac

lightdash 126 Dec 28, 2022
Tools for working with MARC data in Catalogue Bridge.

catbridge_tools Tools for working with MARC data in Catalogue Bridge. Borrows heavily from PyMarc

1 Nov 11, 2021
A 2-dimensional physics engine written in Cairo

A 2-dimensional physics engine written in Cairo

Topology 38 Nov 16, 2022
Processo de ETL (extração, transformação, carregamento) realizado pela equipe no projeto final do curso da Soul Code Academy.

Processo de ETL (extração, transformação, carregamento) realizado pela equipe no projeto final do curso da Soul Code Academy.

Débora Mendes de Azevedo 1 Feb 03, 2022
Python package to transfer data in a fast, reliable, and packetized form.

pySerialTransfer Python package to transfer data in a fast, reliable, and packetized form.

PB2 101 Dec 07, 2022
💬 Python scripts to parse Messenger, Hangouts, WhatsApp and Telegram chat logs into DataFrames.

Chatistics Python 3 scripts to convert chat logs from various messaging platforms into Pandas DataFrames. Can also generate histograms and word clouds

Florian 893 Jan 02, 2023
Exploratory data analysis

Exploratory data analysis An Exploratory data analysis APP TAPIWA CHAMBOKO 🚀 About Me I'm a full stack developer experienced in deploying artificial

tapiwa chamboko 1 Nov 07, 2021
Port of dplyr and other related R packages in python, using pipda.

Unlike other similar packages in python that just mimic the piping syntax, datar follows the API designs from the original packages as much as possible, and is tested thoroughly with the cases from t

179 Dec 21, 2022
🧪 Panel-Chemistry - exploratory data analysis and build powerful data and viz tools within the domain of Chemistry using Python and HoloViz Panel.

🧪📈 🐍. The purpose of the panel-chemistry project is to make it really easy for you to do DATA ANALYSIS and build powerful DATA AND VIZ APPLICATIONS within the domain of Chemistry using using Python a

Marc Skov Madsen 97 Dec 08, 2022
Generates a simple report about the current Covid-19 cases and deaths in Malaysia

Generates a simple report about the current Covid-19 cases and deaths in Malaysia. Results are delay one day, data provided by the Ministry of Health Malaysia Covid-19 public data.

Yap Khai Chuen 7 Dec 15, 2022
High Dimensional Portfolio Selection with Cardinality Constraints

High-Dimensional Portfolio Selecton with Cardinality Constraints This repo contains code for perform proximal gradient descent to solve sample average

Du Jinhong 2 Mar 22, 2022
A project consists in a set of assignements corresponding to a BI process: data integration, construction of an OLAP cube, qurying of a OPLAP cube and reporting.

TennisBusinessIntelligenceProject - A project consists in a set of assignements corresponding to a BI process: data integration, construction of an OLAP cube, qurying of a OPLAP cube and reporting.

carlo paladino 1 Jan 02, 2022
VevestaX is an open source Python package for ML Engineers and Data Scientists.

VevestaX Track failed and successful experiments as well as features. VevestaX is an open source Python package for ML Engineers and Data Scientists.

Vevesta 24 Dec 14, 2022
PyChemia, Python Framework for Materials Discovery and Design

PyChemia, Python Framework for Materials Discovery and Design PyChemia is an open-source Python Library for materials structural search. The purpose o

Materials Discovery Group 61 Oct 02, 2022
ASOUL直播间弹幕抓取&&数据分析

ASOUL直播间弹幕抓取&&数据分析（更新中） 这些文件用于爬取ASOUL直播间的弹幕（其他直播间也可以）和其他信息，以及简单的数据分析生成。

159 Dec 10, 2022
Package for decomposing EMG signals into motor unit firings, as used in Formento et al 2021.

EMGDecomp Package for decomposing EMG signals into motor unit firings, created for Formento et al 2021. Based heavily on Negro et al, 2016. Supports G

13 Nov 01, 2022
This module is used to create Convolutional AutoEncoders for Variational Data Assimilation

VarDACAE This module is used to create Convolutional AutoEncoders for Variational Data Assimilation. A user can define, create and train an AE for Dat

Julian Mack 23 Dec 16, 2022
Python reader for Linked Data in HDF5 files

Linked Data are becoming more popular for user-created metadata in HDF5 files.

The HDF Group 8 May 17, 2022