A fast and easy to use, moddable, Python based Minecraft server!

Related tags

Deep Learningpythonminecraftserverasyncminecraft-serverpluginsasynciopymcmcmc-serverminecraftserverjava-editionmcjeplugins-apimcserverpyminepythonminepythonminecraftmcpyasync-networking
Overview

PyMine

discord views quality contributors code size build status code style

PyMine - The fastest, easiest to use, Python-based Minecraft Server!

Features

Note: This list is not always up to date, and doesn't contain all the features that PyMine offers

  • Joinable - the login process is complete, but users can not yet join the world
  • Packet Models - missing some clientbound packets
  • Status + Login Logic - completed
  • Play Logic - currently a work in progress
  • World Generation - superflat world generation has been started
  • Entities/Entity AI - not started yet
  • Plugin API - completed, but more will be added as the development continues
  • Command/Argument Parsing - currently a work in progress
  • Query Support - completed
  • RCON Support - not started yet

Contributing

Installation / Usage

Check out the docs for more info

Installing from source

  • First, clone the repository git clone https://github.com/py-mine/PyMine.git and move into that directory (cd PyMine)
  • Next, install the required Python packages via pip (python3 -m pip install -r requirements.txt)
  • To run the server, you should run python3 pymine.
  • It is recommended you do not use regular Python, but PyPy3

API/Plugin Examples

Contributors ✨

Thanks goes to these wonderful people (emoji key):


Milo Weinberg
πŸ’» 🎨 πŸ”Œ πŸ”£ πŸ§‘β€πŸ« πŸ“– πŸ’¬ πŸ› πŸ’‘ πŸ€” πŸ“† πŸ‘€ ⚠️
Sh-wayz
πŸ’» πŸ› πŸ“– πŸ’‘ πŸ’¬ πŸ‘€ ⚠️ πŸ“†
Ammar-sys
πŸ“–
Treyver Reicha
πŸ’» πŸ‘€ πŸ€” πŸ› πŸ“† ⚠️
Paul Przybyszewski
πŸ’»
Ashwin Vinod
πŸ€” πŸ’» πŸ“–
imSofi
πŸ›

Kevin Thomas
πŸ€”
Milan Mehra
πŸ€”

This project follows the all-contributors specification. Contributions of any kind welcome!

Owner
PyMine
PyMine
GitHub Repository
SMD-Nets: Stereo Mixture Density Networks

SMD-Nets: Stereo Mixture Density Networks This repository contains a Pytorch implementation of "SMD-Nets: Stereo Mixture Density Networks" (CVPR 2021)

Fabio Tosi 115 Dec 26, 2022
HairCLIP: Design Your Hair by Text and Reference Image

Overview This repository hosts the official PyTorch implementation of the paper: "HairCLIP: Design Your Hair by Text and Reference Image". Our single

322 Jan 06, 2023
Efficient Multi Collection Style Transfer Using GAN

Proposed a new model that can make style transfer from single style image, and allow to transfer into multiple different styles in a single model.

Zhaozheng Shen 2 Jan 15, 2022
Semi-Supervised Learning for Fine-Grained Classification

Semi-Supervised Learning for Fine-Grained Classification This repo contains the code of: A Realistic Evaluation of Semi-Supervised Learning for Fine-G

25 Nov 08, 2022
A Jinja extension (compatible with Flask and other frameworks) to compile and/or compress your assets.

A Jinja extension (compatible with Flask and other frameworks) to compile and/or compress your assets.

Jayson Reis 94 Nov 21, 2022
(SIGIR2020) β€œAsymmetric Tri-training for Debiasing Missing-Not-At-Random Explicit Feedback’’

Asymmetric Tri-training for Debiasing Missing-Not-At-Random Explicit Feedback About This repository accompanies the real-world experiments conducted i

yuta-saito 19 Dec 01, 2022
Regression Metrics Calculation Made easy for tensorflow2 and scikit-learn

Regression Metrics Installation To install the package from the PyPi repository you can execute the following command: pip install regressionmetrics I

Ashish Patel 11 Dec 16, 2022
Official PyTorch Implementation of SSMix (Findings of ACL 2021)

SSMix: Saliency-based Span Mixup for Text Classification (Findings of ACL 2021) Official PyTorch Implementation of SSMix | Paper Abstract Data augment

Clova AI Research 52 Dec 27, 2022
[WACV 2022] Contextual Gradient Scaling for Few-Shot Learning

CxGrad - Official PyTorch Implementation Contextual Gradient Scaling for Few-Shot Learning Sanghyuk Lee, Seunghyun Lee, and Byung Cheol Song In WACV 2

Sanghyuk Lee 4 Dec 05, 2022
This is the official implementation of TrivialAugment and a mini-library for the application of multiple image augmentation strategies including RandAugment and TrivialAugment.

Trivial Augment This is the official implementation of TrivialAugment (https://arxiv.org/abs/2103.10158), as was used for the paper. TrivialAugment is

AutoML-Freiburg-Hannover 94 Dec 30, 2022
Hierarchical probabilistic 3D U-Net, with attention mechanisms (β€”π˜ˆπ˜΅π˜΅π˜¦π˜―π˜΅π˜ͺ𝘰𝘯 𝘜-π˜•π˜¦π˜΅, π˜šπ˜Œπ˜™π˜¦π˜΄π˜•π˜¦π˜΅) and a nested decoder structure with deep supervision (β€”π˜œπ˜•π˜¦π˜΅++).

Hierarchical probabilistic 3D U-Net, with attention mechanisms (β€”π˜ˆπ˜΅π˜΅π˜¦π˜―π˜΅π˜ͺ𝘰𝘯 𝘜-π˜•π˜¦π˜΅, π˜šπ˜Œπ˜™π˜¦π˜΄π˜•π˜¦π˜΅) and a nested decoder structure with deep supervision (β€”π˜œπ˜•π˜¦π˜΅++). Built in TensorFlow 2.5. Configured for vox

Diagnostic Image Analysis Group 32 Dec 08, 2022
DGN pymarl - Implementation of DGN on Pymarl, which could be trained by VDN or QMIX

This is the implementation of DGN on Pymarl, which could be trained by VDN or QM

4 Nov 23, 2022
Shōgun

The SHOGUN machine learning toolbox Unified and efficient Machine Learning since 1999. Latest release: Cite Shogun: Develop branch build status: Donat

Shōgun ML 2.9k Jan 04, 2023
Out-of-Domain Human Mesh Reconstruction via Dynamic Bilevel Online Adaptation

DynaBOA Code repositoty for the paper: Out-of-Domain Human Mesh Reconstruction via Dynamic Bilevel Online Adaptation Shanyan Guan, Jingwei Xu, Michell

197 Jan 07, 2023
Flax is a neural network ecosystem for JAX that is designed for flexibility.

Flax: A neural network library and ecosystem for JAX designed for flexibility Overview | Quick install | What does Flax look like? | Documentation See

Google 3.9k Jan 02, 2023
Library for implementing reservoir computing models (echo state networks) for multivariate time series classification and clustering.

Framework overview This library allows to quickly implement different architectures based on Reservoir Computing (the family of approaches popularized

Filippo Bianchi 249 Dec 21, 2022
QHackβ€”the quantum machine learning hackathon

Official repo for QHackβ€”the quantum machine learning hackathon

Xanadu 72 Dec 21, 2022
Stochastic gradient descent with model building

Stochastic Model Building (SMB) This repository includes a new fast and robust stochastic optimization algorithm for training deep learning models. Th

S. Ilker Birbil 22 Jan 19, 2022
AutoML library for deep learning

Official Website: autokeras.com AutoKeras: An AutoML system based on Keras. It is developed by DATA Lab at Texas A&M University. The goal of AutoKeras

Keras 8.7k Jan 08, 2023
Code for "OctField: Hierarchical Implicit Functions for 3D Modeling (NeurIPS 2021)"

OctField(Jittor): Hierarchical Implicit Functions for 3D Modeling Introduction This repository is code release for OctField: Hierarchical Implicit Fun

55 Dec 08, 2022